PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013906533.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Sphaeropleales; Selenastraceae; Monoraphidium
Family MYB
Protein Properties Length: 577aa    MW: 61836.7 Da    PI: 5.4858
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013906533.1genomeBUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.98.3e-17180226348
                      SS-HHHHHHHHHHHHHTTTT..-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGgg..tWktIartmgkgRtlkqcksrwqkyl 48 
                      +WT+ E+ +l+++v+q+G++  +W +Ia+ ++ gR +kqc++rw+++l
   XP_013906533.1 180 KWTPAEHAKLAQLVEQFGPDnrSWQRIAALIP-GRNGKQCRERWLNHL 226
                      8*****************99************.*************97 PP

2Myb_DNA-binding331.4e-10232274145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      rg WTt E++ l + +  lG+  W++I++++  gRt++  k+rw+
   XP_013906533.1 232 RGGWTTTEELVLCQWHSILGPQ-WSKISKKLA-GRTENATKNRWN 274
                      789*****************88.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.601.102.4E-492193No hitNo description
PROSITE profilePS5129421.426173230IPR017930Myb domain
SuperFamilySSF466893.37E-24175273IPR009057Homeodomain-like
SMARTSM007176.6E-14177228IPR001005SANT/Myb domain
PfamPF002495.9E-16180226IPR001005SANT/Myb domain
CDDcd001672.95E-13180226No hitNo description
Gene3DG3DSA:1.10.10.603.2E-23194233IPR009057Homeodomain-like
SMARTSM007172.4E-9231279IPR001005SANT/Myb domain
PROSITE profilePS5129413.7231281IPR017930Myb domain
PfamPF002491.6E-8232274IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-14234278IPR009057Homeodomain-like
CDDcd001677.60E-7235277No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 577 aa     Download sequence    Send to blast
MQRTRRAAAE QPGADAGTPG IGEGAPGPNT GLLMPRGRGA GRGRGGGAQH GQRQGLEEEA  60
SHVGPQGQQQ QQQEQLHNEG EAGGVASGGE EEEDEEEGEE GEEEEESPGG DDDGDDDEYE  120
SEEDDDEEDD EEYEAAAKAR PARPRVAAPP GAARGSRGGR SGGASEGAGG RGGGRKRVRK  180
WTPAEHAKLA QLVEQFGPDN RSWQRIAALI PGRNGKQCRE RWLNHLRTDI KRGGWTTTEE  240
LVLCQWHSIL GPQWSKISKK LAGRTENATK NRWNGVWRSK ATSSTRRRNT ALTAYISRLR  300
AGIDPAAAFV EVYQIYTPQQ QQQLQQQGAA GVQPPGSGTG PVLPQAFGGP QQQQRQQQQQ  360
QQQQERQQQQ QQQHSHPLWS AHAAAQLELG LGLGQHAPTG AGLPDAAHQQ QQQQQQQQYH  420
QQLQLQVQLQ QQLQALAPQP AVVAGSQQLL ELLQPPPPAL ARPQLAQPHA PMDFELGPAA  480
LAAVIAPPPR PQAQPPLLGE MQSAPAPLPA LRPHAPPQPG PGQQLAPPPQ PQPWHGQRGG  540
AHVARTPTGG ASAQWMAQLM QDLEEGDEGE GGLGLGS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-2318128310110B-MYB
1mse_C9e-231812807104C-Myb DNA-Binding Domain
1msf_C9e-231812807104C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013906533.10.0Transcription factor MYB98
TrEMBLA0A0D2LMG20.0A0A0D2LMG2_9CHLO; Transcription factor MYB98
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP1516114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.17e-29myb domain protein 98
Publications ? help Back to Top
  1. Bogen C, et al.
    Reconstruction of the lipid metabolism for the microalga Monoraphidium neglectum from its genome sequence reveals characteristics suitable for biofuel production.
    BMC Genomics, 2013. 14: p. 926
    [PMID:24373495]